Loading...
Statistics
Advertisement

Lucquez.com

Advertisement
Conversion Technology Metas Server
Lucquez.com is hosted in Switzerland . Lucquez.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Lucquez.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Lucquez.com

Missing HTTPS protocol.

    Meta - Lucquez.com

    Number of occurences: 0

    Server / Hosting

    • IP: 141.8.224.167
    • Latitude: 47.14
    • Longitude: 8.16
    • Country: Switzerland

    Rname

    • ns2.expired.homestead.com
    • ns1.expired.homestead.com
    • mail.mxproc.com

    Target

    • rmgdns111.gmail.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Sun, 24 Apr 2016 08:38:30 GMT Server: Apache Vary: Accept-Encoding,User-Agent Content-Type: text/html; charset=UTF-8

    DNS

    host: lucquez.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 141.8.224.167
    host: lucquez.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2.expired.homestead.com
    host: lucquez.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1.expired.homestead.com
    host: lucquez.com
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: ns1.expired.homestead.com
    5. rname: rmgdns111.gmail.com
    6. serial: 2011101001
    7. refresh: 3600
    8. retry: 900
    9. expire: 604800
    10. minimum-ttl: 86400
    host: lucquez.com
    1. class: IN
    2. ttl: 300
    3. type: PTR
    4. target: ns1.expired.homestead.com
    host: lucquez.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 12032
    5. target: mail.mxproc.com
    host: lucquez.com
    1. class: IN
    2. ttl: 300
    3. type: TXT
    4. txt: v=spf1 ip6:fdaa:50fa:a9ce::/48 -all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ucquez.com, www.luucquez.com, www.uucquez.com, www.l8ucquez.com, www.8ucquez.com, www.l9ucquez.com, www.9ucquez.com, www.ljucquez.com, www.jucquez.com, www.l0ucquez.com, www.0ucquez.com, www.lmucquez.com, www.mucquez.com, www.lpucquez.com, www.pucquez.com, www.loucquez.com, www.oucquez.com, www.lcquez.com, www.luwcquez.com, www.lwcquez.com, www.luecquez.com, www.lecquez.com, www.luscquez.com, www.lscquez.com, www.luacquez.com, www.lacquez.com, www.luquez.com, www.lucdquez.com, www.ludquez.com, www.lucrquez.com, www.lurquez.com, www.luctquez.com, www.lutquez.com, www.lucvquez.com, www.luvquez.com, www.lucfquez.com, www.lufquez.com, www.lucgquez.com, www.lugquez.com, www.luchquez.com, www.luhquez.com, www.lucnquez.com, www.lunquez.com, www.lucmquez.com, www.lumquez.com, www.lucjquez.com, www.lujquez.com, www.lucuez.com, www.lucqeuez.com, www.luceuez.com, www.lucqruez.com, www.lucruez.com, www.lucqvuez.com, www.lucvuez.com, www.lucqbuez.com, www.lucbuez.com, www.lucqnuez.com, www.lucnuez.com, www.lucqfuez.com, www.lucfuez.com, www.lucqguez.com, www.lucguez.com, www.lucqhuez.com, www.luchuez.com, www.lucqyuez.com, www.lucyuez.com, www.lucqez.com, www.lucquwez.com, www.lucqwez.com, www.lucqueez.com, www.lucqeez.com, www.lucqusez.com, www.lucqsez.com, www.lucquaez.com, www.lucqaez.com, www.lucquz.com, www.lucquexz.com, www.lucquxz.com, www.lucquesz.com, www.lucqusz.com, www.lucquewz.com, www.lucquwz.com, www.lucquerz.com, www.lucqurz.com, www.lucquefz.com, www.lucqufz.com, www.lucquevz.com, www.lucquvz.com, www.lucquecz.com, www.lucqucz.com, www.lucqueqz.com, www.lucquqz.com, www.lucqueaz.com, www.lucquaz.com, www.lucqueyz.com, www.lucquyz.com, www.lucque.com, www.lucquezt.com, www.lucquet.com, www.lucqueza.com, www.lucquea.com, www.lucquezs.com, www.lucques.com, www.lucquezx.com, www.lucquex.com, www.lucquezc.com, www.lucquec.com, www.lucquezg.com, www.lucqueg.com, www.lucquezh.com, www.lucqueh.com, www.lucquezj.com, www.lucquej.com, www.lucquezu.com, www.lucqueu.com,

    Other websites we recently analyzed

    1. Ortis DRUKARNIA, druk czasopism, magazynów, druk folderów, druk książek, karty plastikowe
      Specjalizujemy się w druku średnio i wysokonakładowym, stosując technologię druku rolowego heatsetowego i arkuszowego. Posiadamy nowoczesne studio graficzne wykonujące usługi potrzebne do przygotowania produkcji do druku.
      Poland - 89.161.134.63
      Server software: IdeaWebServer/v0.80
      Technology: CSS, Html, Html5, Javascript, jQuery Cycle, Php, Google Analytics
      Number of Javascript: 4
      Number of meta tags: 5
    2. ELEKTRON vzw — Elektron vzw
      Belgium - 134.58.64.191
      Server software:
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 3
      Number of meta tags: 5
    3. Event Scheduler
      Philadelphia (United States) - 208.242.14.183
      Server software:
      Technology: CSS, Html, Javascript, Google Analytics
      Number of meta tags: 1
    4. www.snbootshoes.com
      Scottsdale (United States) - 184.168.221.31
      Server software: Microsoft-IIS/7.5
      Technology: Html
    5. bharatb2b.co.in
      Noida (India) - 202.71.129.17
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Javascript, Swf Object
      Number of meta tags: 4
    6. À岩
      Shanghai (China) - 222.73.144.185
      Server software: Nginx
      Technology: CSS, Html, Iframe, Swf Object
      Number of meta tags: 1
    7. zyprian photographie | Das mobile Fotostudio – Events – Werbung – Hochzeiten
      Germany - 82.165.196.138
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Colorbox, Php, Pingback, Wordpress
      Number of Javascript: 5
      Number of meta tags: 3
    8. Trigrid Internship
      Scottsdale (United States) - 50.63.97.128
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Javascript
      Number of Javascript: 3
      Number of meta tags: 1
    9. christsmercychurch.com
      The official webpage of Christ's Mercy Church in Katy, Texas. Find out about who we are and what we do, as well as sermons and discipleship lessons.
      New York (United States) - 198.185.159.144
      Server software:
      Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
      Number of Javascript: 2
      Number of meta tags: 7
    10. smallkitchenappliancesreview.com
      Virgin Islands, British - 208.91.197.13
      Server software: Apache
      Technology: Html
      Number of meta tags: 2

    Check Other Websites